PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01123.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family G2-like
Protein Properties Length: 370aa    MW: 40495 Da    PI: 8.2283
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01123.1_g00007.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.3e-32223278156
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                              k+r++W+peLH+rF++a++qLGGs++AtPk+i+++mkv+gLt+++vkSHLQkYRl+
  Rsa1.0_01123.1_g00007.1 223 KQRRCWSPELHRRFLHALQQLGGSHVATPKQIRDHMKVDGLTNDEVKSHLQKYRLH 278
                              79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.08E-17220281IPR009057Homeodomain-like
PROSITE profilePS5129415.038220280IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.0E-28221281IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-26223278IPR006447Myb domain, plants
PfamPF002496.0E-8225276IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0055062Biological Processphosphate ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MDAQKMQRCH EYVEALEEEQ KKIQVFQREL PLCLELVTQA IEACRKELSS TSTTSEQCSE  60
QTTSVSGGPV LEEFIPTKKT EENGEHESPT PPEENVKRSD WLRSVQLWNP SPDTNTNTNE  120
VSNPERVVGK KAKVVEVKPN NSNCGGFQPF QREKKRVFSE SNDPQPAAVK AVDSAPAVKA  180
VASAPAPATT TSSTTETCGV VGKGGEEHIH QQQSQTQSQT RRKQRRCWSP ELHRRFLHAL  240
QQLGGSHVAT PKQIRDHMKV DGLTNDEVKS HLQKYRLHTR RPAASMTPQG NGNSQQPQFV  300
VVGGIWVPSP QDVPPPSDVA NNSGGIYAPV TLRPPPSPQS PKRSVERSSG QCNSQAASSS  360
TNTATSSPVS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00218DAPTransfer from AT1G68670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013737217.10.0PREDICTED: uncharacterized protein LOC106440164
TrEMBLM4FB940.0M4FB94_BRARP; Uncharacterized protein
STRINGBra038360.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34912863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.15e-96G2-like family protein